PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn177831
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 456aa    MW: 52862.7 Da    PI: 6.3725
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn177831genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK37.64.5e-12319358342
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIk 42 
                   i+ledl+ +F  + +dAAk Lgv++++ Kr CR++GIk
  Achn177831 319 RVITLEDLQPHFGRKHADAAKILGVSVSTFKRYCRRNGIK 358
                 569************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.297304389IPR003035RWP-RK domain
PfamPF020427.1E-12321358IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MYFVSSQRKY DHTILKESDG AYRIFLLYII VHIYAQIKEL NDLIEARLVE KLSKRRSGTA  60
KKKRSGRYRT QERESEVERE REMDPKLKEV SQLFERFKAA FIRNDFDTCT KLLSKLKVLL  120
TEFRSLPPLF EETPNAIDEL TIARDIYEHA VVLSVKIEDQ DAFERDFFQL KPYYTDACLL  180
FADNLKDLKN IRKQLYSAAE YFERSYDKDD QKHIVVESVK DYITKAIVNT VDHLGSVAYK  240
VNHFLDEKVD QFSGTELQFS CIEQELRQQL NRCSLEEETS VEIINPSMDE KFDSRQLDSS  300
EQQMKNAMET PERKRQTKRV ITLEDLQPHF GRKHADAAKI LGVSVSTFKR YCRRNGIKWK  360
NVNEYSQALE LDPKHRETPG EKTTPSCKTP SITGQAETGN QVLDSGMVEI KGNLPEQNNF  420
QTDNVLKEVS RETSTSHGLC PYNCPEMDLS ASYTS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15363KRRSGTAKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8698622e-94DQ869862.1 Camellia sinensis 26S proteasome regulatory particle non-ATPase subunit 12 mRNA, complete cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-07Nin-like family protein